DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Heyl

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:163 Identity:43/163 - (26%)
Similarity:80/163 - (49%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            |.||..:.::|::||.|||..|.:|:.|:....:::|.  ::||||::|::||||::.|...|| 
  Rat    42 QARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLKMLHASGG- 103

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRS-GYVHAADQITQVL--LQ--TQQTDEIGRKIMKFLSTRL 134
                  ||.     ..:.|....||| |:.....::.:.|  |:  :...|.:..:::..|::..
  Rat   104 ------AGF-----FDARALAVDFRSIGFRECLTEVVRYLGVLEGPSSHADPVRIRLLSHLNSYA 157

  Fly   135 IELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPL 167
            .|::..                |.::|.||||:
  Rat   158 AEMEPS----------------PTTTGALAFPV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 22/58 (38%)
ORANGE 96..136 CDD:128787 8/44 (18%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 27/80 (34%)
ORANGE 115..162 CDD:128787 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.