DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005155978.1 Gene:her2 / 30300 ZFINID:ZDB-GENE-980526-274 Length:133 Species:Danio rerio


Alignment Length:114 Identity:32/114 - (28%)
Similarity:60/114 - (52%) Gaps:15/114 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQ 77
            |:.||::|:.||.|||||::.|| ::::...:..:..::||||||||:.|.:::..         
Zfish    17 KLRKPVVEKMRRDRINKCIEQLK-ILLKTEIKASQPCSKLEKADILEMAVIYLKNT--------- 71

  Fly    78 GVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKI 126
                 ..:...|.|.||.:|:..||....::..:.|...:||.:..:.:
Zfish    72 -----ADAHARSYSEAHAQSYADGYSRCIEETARFLSAHKQTQKHSKPV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 22/56 (39%)
ORANGE 96..136 CDD:128787 6/31 (19%)
her2XP_005155978.1 HLH 13..70 CDD:238036 22/53 (42%)
ORANGE 85..133 CDD:128787 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.