powered by:
Protein Alignment E(spl)m3-HLH and Hes7
DIOPT Version :9
Sequence 1: | NP_524509.2 |
Gene: | E(spl)m3-HLH / 43156 |
FlyBaseID: | FBgn0002609 |
Length: | 224 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038941367.1 |
Gene: | Hes7 / 287423 |
RGDID: | 1305914 |
Length: | 358 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 47/72 - (65%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQ 77
:::|||:|::||.|||:.|::|:.|::|..:.:.....:||||:|||..|.::| :|..:...
Rat 43 EMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLR---ERSRVEPP 104
Fly 78 GVVAGVG 84
|...|||
Rat 105 GTARGVG 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
E(spl)m3-HLH | NP_524509.2 |
HLH |
11..70 |
CDD:238036 |
22/56 (39%) |
ORANGE |
96..136 |
CDD:128787 |
|
Hes7 | XP_038941367.1 |
bHLH-O_HES7 |
44..102 |
CDD:381468 |
23/60 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166334620 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4304 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.