Sequence 1: | NP_524509.2 | Gene: | E(spl)m3-HLH / 43156 | FlyBaseID: | FBgn0002609 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036391.1 | Gene: | HEY2 / 23493 | HGNCID: | 4881 | Length: | 337 | Species: | Homo sapiens |
Alignment Length: | 298 | Identity: | 58/298 - (19%) |
---|---|---|---|
Similarity: | 102/298 - (34%) | Gaps: | 101/298 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
Fly 77 QGVVAGVGSPPTSTSTAH---VESFRSGYVHAADQITQVLLQTQ---QTDEIGRKIMKFLSTRLI 135
Fly 136 ELQTQLLQQQQQQQQH-----------------------------------QQQQIPQSSG---- 161
Fly 162 ---------RLAFPLLGGYGP------------------AAAAAAISYSSFLTSKDELIDVTSVD 199
Fly 200 GNA-------------LSETASVSSQESGASEPVWRPW 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m3-HLH | NP_524509.2 | HLH | 11..70 | CDD:238036 | 23/57 (40%) |
ORANGE | 96..136 | CDD:128787 | 6/42 (14%) | ||
HEY2 | NP_036391.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..52 | 2/2 (100%) | |
bHLH-O_HEY2 | 40..121 | CDD:381490 | 28/87 (32%) | ||
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 | 47..116 | 27/82 (33%) | |||
ORANGE | 119..165 | CDD:128787 | 6/45 (13%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 307..337 | 8/24 (33%) | |||
YRPW motif | 327..330 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140901 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |