DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and HEY1

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:287 Identity:62/287 - (21%)
Similarity:99/287 - (34%) Gaps:109/287 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQE--GEHVTRLEKADILELTVDHMRKLKQRGG- 73
            ||..:.::|::||.|||..|.:|:.|:....:::  .:...:||||:||::||||::.|...|| 
Human    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGK 114

  Fly    74 ---------------------------LSL----------------------------QGVVAGV 83
                                       ||:                            .|..||:
Human   115 GYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGL 179

  Fly    84 GSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQ 148
            |..|..|...|       :.|.|..:   ||........|....          .|:...|.:..
Human   180 GHIPWGTVFGH-------HPHIAHPL---LLPQNGHGNAGTTAS----------PTEPHHQGRLG 224

  Fly   149 QQHQQQ---------------QIPQSSGRLAFPLLGGYGPAAAAAAISYSSF-LTSKDELIDVTS 197
            ..|.:.               .:..|:.:|:.|||.... :.:|...|:.|| |.|.        
Human   225 SAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVA-SLSAFPFSFGSFHLLSP-------- 280

  Fly   198 VDGNALSETASVSSQESGASEPVWRPW 224
               ||||.:|  .:|.:...:| :|||
Human   281 ---NALSPSA--PTQAANLGKP-YRPW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 22/59 (37%)
ORANGE 96..136 CDD:128787 5/39 (13%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
bHLH_SF 41..126 CDD:381792 24/75 (32%)
ORANGE 124..170 CDD:128787 2/45 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 5/47 (11%)
YRPW motif 298..301 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.