DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and ref-1

DIOPT Version :10

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_496204.1 Gene:ref-1 / 174585 WormBaseID:WBGene00004334 Length:367 Species:Caenorhabditis elegans


Alignment Length:58 Identity:14/58 - (24%)
Similarity:31/58 - (53%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLK 69
            ||.:|...|:.||.|..:..|.||:.::|........|.::::.:.|::.:.:::..|
 Worm   163 RKEVKKNREQDRRDRQGEAFDALKNFIIENKLMTSHQVEKMQRLNTLDIIIAYIQNKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 bHLH-O_ESMB_like 5..71 CDD:381584 14/58 (24%)
ORANGE 96..136 CDD:128787
ref-1NP_496204.1 HLH 20..66 CDD:197674
HLH 170..217 CDD:197674 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.