DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hey2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_569101.1 Gene:Hey2 / 155430 RGDID:621405 Length:339 Species:Rattus norvegicus


Alignment Length:300 Identity:62/300 - (20%)
Similarity:108/300 - (36%) Gaps:103/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||..:.::|::||.|||..|.:|:.|:....:::|.  .:||||:||::||||::.|:..||   
  Rat    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQATGG--- 108

  Fly    77 QGVVAGVGSPPTSTSTAH--VESFRS-GYVHAADQITQVLLQTQ---QTDEIGRKIMKFLSTRLI 135
            :|..           .||  ...|.| |:.....::.:.|...:   .:|.:..:::..|||...
  Rat   109 KGYF-----------DAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCAS 162

  Fly   136 ELQTQLLQQQQQQQQH-----------------------------------QQQQIPQSSG---- 161
            :.:..::........|                                   ...::|.:.|    
  Rat   163 QREAAVMTSSMSHHHHPLHPHHWAAAFHHLPTSLLQPNGLHTSESTPCRLSTSSEVPPAHGSALL 227

  Fly   162 ---------RLAFPLLGGYGP-------------------AAAAAAISYS---SFLTSKDEL--- 192
                     .|..|..|...|                   ||||.|.::|   ||..:...|   
  Rat   228 TATFAHADSALRMPSTGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSN 292

  Fly   193 ------IDVTSVDGNALSETASVSSQE--SGASEPVWRPW 224
                  :...:.....||.:|:.|.|:  ||.:...:|||
  Rat   293 AAAAAAVAAATAISPPLSVSAASSPQQTSSGTNSKPYRPW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/57 (40%)
ORANGE 96..136 CDD:128787 8/43 (19%)
Hey2NP_569101.1 HLH 49..105 CDD:238036 23/57 (40%)
ORANGE 120..165 CDD:128787 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.