Sequence 1: | NP_524509.2 | Gene: | E(spl)m3-HLH / 43156 | FlyBaseID: | FBgn0002609 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038932.1 | Gene: | Hey2 / 15214 | MGIID: | 1341884 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 300 | Identity: | 59/300 - (19%) |
---|---|---|---|
Similarity: | 103/300 - (34%) | Gaps: | 103/300 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
Fly 77 QGVVAGVGSPPTSTSTAH--VESFRS-GYVHAADQITQVLLQTQ---QTDEIGRKIMKFLSTRLI 135
Fly 136 ELQTQLLQQQQQQQQH-----------------------------------QQQQIPQSSG---- 161
Fly 162 ---------RLAFPLLGGYGP------------------AAAAAAISYSSF---------LTSKD 190
Fly 191 ELIDVTSVDGNALSETASVSSQES------GASEPVWRPW 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m3-HLH | NP_524509.2 | HLH | 11..70 | CDD:238036 | 23/57 (40%) |
ORANGE | 96..136 | CDD:128787 | 8/43 (19%) | ||
Hey2 | NP_038932.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..52 | 2/2 (100%) | |
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000269|PubMed:11486045 | 47..116 | 27/82 (33%) | |||
HLH | 49..105 | CDD:238036 | 23/57 (40%) | ||
ORANGE | 120..165 | CDD:128787 | 8/44 (18%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..339 | 6/22 (27%) | |||
YQPW motif | 329..332 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830864 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |