DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:243 Identity:59/243 - (24%)
Similarity:95/243 - (39%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHV--TRLEKADILELTVD 63
            :.:||....:..::.||::|:.||.|||..::.|| |::|  |:...|.  ::||||||||:.|.
Mouse   224 VAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE--QEFARHQPNSKLEKADILEMAVS 285

  Fly    64 HMRKLKQRGG----LSLQGVVAGVG-SP------PTSTSTA------HVESFRSGYVHAADQITQ 111
            :::..|...|    |.|...||... :|      ||:.:.|      | :.:..||.....:..|
Mouse   286 YLKHSKGEPGACARLLLPADVAPTARAPLMPLRLPTAFAAAAGPKSLH-QDYSEGYSWCLQEAVQ 349

  Fly   112 VLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAA 176
            .|.....:|                .|.:||        :..|:.|..:.....|...|..|..|
Mouse   350 FLTLHAASD----------------TQMKLL--------YHFQRPPAPAAPAKEPPAPGAAPQPA 390

  Fly   177 AAAISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEPVWRPW 224
            .:                      :|.:..|:||:....|. .:||||
Mouse   391 RS----------------------SAKAAAAAVSTSRQPAC-GLWRPW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/60 (38%)
ORANGE 96..136 CDD:128787 5/39 (13%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 23/58 (40%)
ORANGE 334..369 CDD:128787 8/58 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.