DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:219 Identity:58/219 - (26%)
Similarity:85/219 - (38%) Gaps:77/219 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            :.||.:|||||::||||||:.|..||.|::..|..|....::||||||||:||..:::       
Mouse    12 ELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQE------- 69

  Fly    75 SLQGVVAGVGSPPTSTSTA---HVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIE 136
                      .|.|..|:|   .:.|:..||.....::.:||......:..       :|.||:|
Mouse    70 ----------QPATLYSSAAPGPLNSYLEGYRACLARLARVLPACSVLEPA-------VSARLLE 117

  Fly   137 LQTQLLQQQQQQQQH-QQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDG 200
                          | :|:.:...|..|..|      ||.|.|                      
Mouse   118 --------------HLRQRTVSDDSPSLTLP------PAPAPA---------------------- 140

  Fly   201 NALSETASVSSQESGASEPVWRPW 224
                  .|......|:| .:||||
Mouse   141 ------PSPPVPPPGSS-GLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 8/39 (21%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 30/77 (39%)
ORANGE 85..123 CDD:128787 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 12/67 (18%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.