DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her9

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:272 Identity:72/272 - (26%)
Similarity:120/272 - (44%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.| ||..:
Zfish    33 EHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNL-QRVQM 96

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRKIMKFLSTRLIELQ 138
                      |...|..|..:..:|:|:....:::|:.|...:..: |:..:::..||..:.::.
Zfish    97 ----------SAALSADTNVLSKYRAGFNECMNEVTRFLSTCEGVNTEVRSRLLNHLSGCMGQMM 151

  Fly   139 TQLLQQQQQQQQ-------HQQ------------------------------QQIPQSSGRLAF- 165
            .....|....||       |.|                              |.:|.:.|:.|| 
Zfish   152 AMNYPQPAPAQQAHLAQPLHVQLPSTLPINGASMGSKLSPSEAVSPKVFGGFQLVPATDGQFAFL 216

  Fly   166 -----------PLLGGYGPAAA-----AAAISYSSFLTSKDELIDVTSVDG--NALSETASVSSQ 212
                       |::..|..|:.     |:.:..||..|....:..:||..|  .|:|.....:..
Zfish   217 IPNPAFASATTPVIPLYANASVPVTVNASPVQASSAPTVASPVQGMTSFSGVPQAVSPVGVSAGA 281

  Fly   213 ESGASEPVWRPW 224
            ||  :|||||||
Zfish   282 ES--NEPVWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 7/40 (18%)
her9NP_571948.1 HLH 32..93 CDD:238036 29/60 (48%)
Hairy_orange 110..147 CDD:284859 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.