Sequence 1: | NP_524509.2 | Gene: | E(spl)m3-HLH / 43156 | FlyBaseID: | FBgn0002609 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571948.1 | Gene: | her9 / 140613 | ZFINID: | ZDB-GENE-011213-1 | Length: | 291 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 72/272 - (26%) |
---|---|---|---|
Similarity: | 120/272 - (44%) | Gaps: | 70/272 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
Fly 75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRKIMKFLSTRLIELQ 138
Fly 139 TQLLQQQQQQQQ-------HQQ------------------------------QQIPQSSGRLAF- 165
Fly 166 -----------PLLGGYGPAAA-----AAAISYSSFLTSKDELIDVTSVDG--NALSETASVSSQ 212
Fly 213 ESGASEPVWRPW 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m3-HLH | NP_524509.2 | HLH | 11..70 | CDD:238036 | 29/58 (50%) |
ORANGE | 96..136 | CDD:128787 | 7/40 (18%) | ||
her9 | NP_571948.1 | HLH | 32..93 | CDD:238036 | 29/60 (48%) |
Hairy_orange | 110..147 | CDD:284859 | 7/36 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573820 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |