DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:237 Identity:64/237 - (27%)
Similarity:99/237 - (41%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKL---- 68
            ||   |:...|:|:|||.|||:|:..||||:.|.|:.  ..:..||||.:||||:.|::.|    
  Rat    44 TY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKL--TTLGHLEKAVVLELTLKHLKALTALT 103

  Fly    69 --KQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLS 131
              :.:..::||.....:.||    ..|.:::|.||:...|.::.|.|.:.:.......:..:.:|
  Rat   104 EQQHQKIIALQNGERSLKSP----VQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRCAQLVS 164

  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGP-----AAAAAAISYSSFL----- 186
             .|..:.||||..|                     :..|.||     :|.|||.|.|..:     
  Rat   165 -HLHAVATQLLTPQ---------------------VTPGRGPGRAPCSAGAAAASGSERVARCVP 207

  Fly   187 --------TSKDELIDVTS-VDGNALSETASVSSQESGASEP 219
                    |..:...|..| ..|.|....|:|..:..|...|
  Rat   208 VIQRTQPGTEPEHDTDTDSGYGGEAEQGRAAVKQEPPGDPSP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 26/64 (41%)
ORANGE 96..136 CDD:128787 8/39 (21%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 30/82 (37%)
ORANGE 129..175 CDD:128787 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.