DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and LOC116412194

DIOPT Version :10

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_031761713.1 Gene:LOC116412194 / 116412194 XenbaseID:XB-GENE-29098231 Length:155 Species:Xenopus tropicalis


Alignment Length:78 Identity:28/78 - (35%)
Similarity:45/78 - (57%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHV-TRLEKADILELTV----DHM- 65
            |....||:.||::|:.||.|||..::.|:.|:.:  :.|..|: ::.|||||||:.|    .|| 
 Frog    17 KAQGIRKMRKPVVEKMRRDRINSSIEQLRMLLEK--EFESHHLPSKPEKADILEMAVSFLQQHMA 79

  Fly    66 RKLKQRGGLSLQG 78
            .|..|...:.::|
 Frog    80 TKYAQSSLVQIEG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 bHLH-O_ESMB_like 5..71 CDD:381584 26/69 (38%)
ORANGE 96..136 CDD:128787
LOC116412194XP_031761713.1 bHLH-O_HES5 23..77 CDD:381467 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.