DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes7.2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:256 Identity:65/256 - (25%)
Similarity:100/256 - (39%) Gaps:64/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MSKTYQYR---KVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMR 66
            |..:|..|   ::|||::|::||.|||:.|:.|:.|::|....|.....:.||||||:.|| |..
 Frog    15 MRNSYPNREDKRLMKPVIEKRRRDRINQSLEHLRTLLLEATHDETLKNPKAEKADILKKTV-HFL 78

  Fly    67 KLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLS 131
            |:              ..:|..|.....:..|:.|:....:|.|..|   ...|.|.:|..:::.
 Frog    79 KM--------------CHNPVPSDGKKLLSGFKGGFREGLNQATSFL---NSADSICQKKKEYVV 126

  Fly   132 TRLIELQTQLLQQQQQQQQH-----------QQQQIPQSSGRLAFPLLG---GYG---------- 172
            .||    .|.::||.|:..|           |:|.:|..      ||:.   |.|          
 Frog   127 QRL----CQHMEQQTQKHCHDSAQDVSSRVNQRQILPSP------PLISRVTGNGLEQSPETQTS 181

  Fly   173 -PAAAAAAISYSSFLT----SKDELIDVTSVDGNA----LSETASVSSQESGASEPVWRPW 224
             |..:......|||.|    .:.:.....:...|.    ...|....:..|..|..|||||
 Frog   182 RPPHSHHPSPSSSFRTPCMGQEQQQTPPQTFQANTNKKPTQRTLFPPTSSSVNSALVWRPW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 25/61 (41%)
ORANGE 96..136 CDD:128787 10/39 (26%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 24/58 (41%)
ORANGE 94..138 CDD:128787 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.