DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes5.3

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:220 Identity:51/220 - (23%)
Similarity:82/220 - (37%) Gaps:83/220 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TYQYRKVMKPLLERKRRARINKCLDDLKDLM---VECLQQEGEHVTRLEKADILELTVDHMRKLK 69
            |.|..|:.||::|:.||.|||..::.|::|:   .:.||.:    ::.||||||||.|   :.||
 Frog    21 TKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPD----SKPEKADILELAV---KFLK 78

  Fly    70 QRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRL 134
            |:  :..|          :..:....:.|..||.:...: |...|...:|:|             
 Frog    79 QQ--ICSQ----------SKNNRKDYQDFSQGYSNCLHE-TFAFLSFHRTEE------------- 117

  Fly   135 IELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVD 199
             |:|.:|:...|.... |.:.|..||.....|     ||.|                        
 Frog   118 -EMQLKLMNHFQCLDS-QPRGISVSSSHQKGP-----GPVA------------------------ 151

  Fly   200 GNALSETASVSSQESGASEPVWRPW 224
                            :::.:||||
 Frog   152 ----------------STKILWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/61 (38%)
ORANGE 96..136 CDD:128787 7/39 (18%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 25/66 (38%)
Hairy_orange 93..135 CDD:383064 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.