DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:223 Identity:52/223 - (23%)
Similarity:92/223 - (41%) Gaps:66/223 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            :.||.:|||:|::||||||:.|:.||.|::..:.::....::||||||||:||..:|.:      
 Frog    27 ELRKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLRDI------ 85

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQ-QTDEIGRKIMKFLSTRLIELQ 138
                       ||...... .:.::.||....::::.:|.::. .|.|...:::..|. |..||.
 Frog    86 -----------PPVPAQNP-ADRYKEGYRACVERLSAILNKSHVLTGEASNRLLNHLQ-RSPELC 137

  Fly   139 TQLLQQQQQQQQHQQQQI----PQSSGRLAFPLL---GGYGPAAAAAAISYSSFLTSKDELIDVT 196
            ..  ......:.|..:.:    |::| :|..|||   ..:.||.....::.|             
 Frog   138 CS--DCHHPPKSHSPRIVLHVSPRTS-QLESPLLNQPSSHRPAPCPPQLNSS------------- 186

  Fly   197 SVDGNALSETASVSSQESGASEPVWRPW 224
                                   :||||
 Frog   187 -----------------------IWRPW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 27/58 (47%)
ORANGE 96..136 CDD:128787 7/40 (18%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 29/78 (37%)
Hairy_orange 97..133 CDD:369405 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.