DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kaz-m1 and LOC1278048

DIOPT Version :10

Sequence 1:NP_524507.1 Gene:Kaz-m1 / 43154 FlyBaseID:FBgn0002578 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_317576.4 Gene:LOC1278048 / 1278048 VectorBaseID:AGAMI1_010584 Length:82 Species:Anopheles gambiae


Alignment Length:59 Identity:16/59 - (27%)
Similarity:30/59 - (50%) Gaps:9/59 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EVKECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRLLREEKC 156
            |:..|  .|.:||:|||.:|.:   ..:|.|:|:   ||.:....:...|.: :::..|
Mosquito    29 EMATC--ACQLIYRPVCASNNE---SYSNECVLK---CASETPTGRSIGLHK-VKDGNC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kaz-m1NP_524507.1 KAZAL 29..>67 CDD:197624
LOC1278048XP_317576.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.