DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and BHLHE40

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_003661.1 Gene:BHLHE40 / 8553 HGNCID:1046 Length:412 Species:Homo sapiens


Alignment Length:193 Identity:59/193 - (30%)
Similarity:92/193 - (47%) Gaps:33/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMK 68
            :..:||   |:...::|:|||.|||:|:.:|||::.|  .||..|    .||||.:||||::|:|
Human    48 DSKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLG----HLEKAVVLELTLKHVK 105

  Fly    69 KLR---AQKQLRLSSVTGGVSPSADPKLSI---AESFRAGYVHAANEVSKTLAAVPGVSVDLGTQ 127
            .|.   .|:|.::.::..|:........::   .|.|.:|:...|.||.:.||..........:|
Human   106 ALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQ 170

  Fly   128 LMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGP 190
            |::|| ||      ||..|..|...:.|.:      |.|...|..|..:     |.|..:.||
Human   171 LVTHL-HR------VVSELLQGGTSRKPSD------PAPKVMDFKEKPS-----SPAKGSEGP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 28/66 (42%)
ORANGE 97..141 CDD:128787 14/43 (33%)
BHLHE40NP_003661.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer 1..139 32/97 (33%)
bHLH-O_DEC1 40..129 CDD:381592 32/87 (37%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 75..79 3/3 (100%)
ORANGE 140..184 CDD:128787 17/50 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..303 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.