DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:223 Identity:66/223 - (29%)
Similarity:95/223 - (42%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLS 79
            |::||::|::||.|||:.|:||:.:::|....:.....:||||:|||..|.::::       |..
Mouse    14 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE-------RSR 71

  Fly    80 SVTGGV--SPSADPKLSIAESFRAGYVHAANEVSKTLAA-VPGVSVDLGTQLMSHL-GHRL---N 137
            ....||  ||..|     ||:..:.|:....|....||| ....|....:||.|.| |:|.   .
Mouse    72 VEPPGVPRSPGQD-----AEALASCYLSGFRECLLRLAAFAHDASPAARSQLFSALHGYRRPKPP 131

  Fly   138 YLQVVVPSLP------------IGVPL-QAPVEDQAMVTP----PPSECDSL--ESGACSP---- 179
            ..:.|.|.||            :|..| |.|...|...:|    .||.|.|.  :|||.:|    
Mouse   132 RPEAVDPGLPAPRPPLDPASPILGPALHQRPPVHQGPPSPRLAWSPSHCSSRAGDSGAPAPLTGL 196

  Fly   180 ------------APSEASSTSGPMWRPW 195
                        ||...|......||||
Mouse   197 LPPPPPPYRQDGAPKAPSLPPPAFWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 21/59 (36%)
ORANGE 97..141 CDD:128787 13/48 (27%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 22/65 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 27/101 (27%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.