Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_445780.2 | Gene: | Bhlhe40 / 79431 | RGDID: | 68439 | Length: | 411 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 60/202 - (29%) |
---|---|---|---|
Similarity: | 94/202 - (46%) | Gaps: | 36/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMK 68
Fly 69 KLR---AQKQLRLSSVTGGVSPSADPKLSI---AESFRAGYVHAANEVSKTLAAVPGVSVDLGTQ 127
Fly 128 LMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDS----LESGA------CSPAPS 182
Fly 183 EASSTSG 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 28/66 (42%) |
ORANGE | 97..141 | CDD:128787 | 14/43 (33%) | ||
Bhlhe40 | NP_445780.2 | Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250 | 1..139 | 33/97 (34%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||||
bHLH-O_DEC1 | 40..129 | CDD:381592 | 32/87 (37%) | ||
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 | 75..79 | 3/3 (100%) | |||
ORANGE | 140..184 | CDD:128787 | 17/50 (34%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 186..293 | 9/50 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334603 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |