DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:225 Identity:62/225 - (27%)
Similarity:100/225 - (44%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK- 68
            :||....:..::.||::|:.||.|||..:::|| :::|......:..::||||||||:.|.::| 
  Rat     8 VEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLEQEFARHQPNSKLEKADILEMAVSYLKH 71

  Fly    69 ---KLRAQKQLRLSSVTGGVSP-----------------SADPKLSIAESFRAGYVHAANEVSK- 112
               :|.|..::.|.:   ||:|                 :|.|| |:.:.:..||.....|..: 
  Rat    72 SKGELGACARVLLPT---GVAPTARAPLMPLGLPTAFAAAAGPK-SLHQDYSEGYSWCLQEAVQF 132

  Fly   113 -TLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGA 176
             ||.|    :.|...:|:.|...         |..|     .|||::    ||.|        ||
  Rat   133 LTLHA----ASDTQMKLLYHFQR---------PPAP-----AAPVKE----TPTP--------GA 167

  Fly   177 CSPAPSEAS-------STSGP----MWRPW 195
             :|.|:.:|       |||..    :||||
  Rat   168 -APQPARSSTKAAASVSTSRQSACGLWRPW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/65 (35%)
ORANGE 97..141 CDD:128787 9/45 (20%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 21/56 (38%)
ORANGE 116..158 CDD:128787 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.