Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038966759.1 | Gene: | Hes5 / 79225 | RGDID: | 621340 | Length: | 196 | Species: | Rattus norvegicus |
Alignment Length: | 225 | Identity: | 62/225 - (27%) |
---|---|---|---|
Similarity: | 100/225 - (44%) | Gaps: | 70/225 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 MEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK- 68
Fly 69 ---KLRAQKQLRLSSVTGGVSP-----------------SADPKLSIAESFRAGYVHAANEVSK- 112
Fly 113 -TLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGA 176
Fly 177 CSPAPSEAS-------STSGP----MWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 23/65 (35%) |
ORANGE | 97..141 | CDD:128787 | 9/45 (20%) | ||
Hes5 | XP_038966759.1 | bHLH-O_HES5 | 18..74 | CDD:381467 | 21/56 (38%) |
ORANGE | 116..158 | CDD:128787 | 11/59 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334611 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X1011 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |