DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and hes2.2

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:194 Identity:58/194 - (29%)
Similarity:90/194 - (46%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQL 76
            :.||.:||:||:|||||||..||.||.:::....::....::||||||||:||..:..::     
Zfish     7 ELRKTLKPLLEKKRRARINDSLDRLKALILPLTGKDNCRYSKLEKADILEMTVRFLTDIQ----- 66

  Fly    77 RLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLN-YLQ 140
                    .:||.|    .|.||..||......||   |.:|..|:|..|:      ||:| ::|
Zfish    67 --------TTPSKD----TAVSFTEGYTTCLQRVS---ARLPQTSLDAETR------HRVNDFIQ 110

  Fly   141 -VVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGP--------MWRPW 195
             .|:|..|  .......:...|::....:..:|:|.:......:....|.|        :||||
Zfish   111 RSVMPKTP--ACQNCCAQSSRMMSQIQQKLQNLKSSSSRSTNPKQDILSRPEPVPLITEVWRPW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 27/61 (44%)
ORANGE 97..141 CDD:128787 15/45 (33%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.