DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and hes5.10

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001039178.1 Gene:hes5.10 / 734014 XenbaseID:XB-GENE-876529 Length:166 Species:Xenopus tropicalis


Alignment Length:191 Identity:46/191 - (24%)
Similarity:81/191 - (42%) Gaps:63/191 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLS 79
            |:.||::|:.||.|||..:::|: |::|...|.....::||||||||:.|.:::: :.:.|:..|
 Frog    23 KIRKPVIEKMRRDRINHSIEQLR-ILLERNFQTHHPHSKLEKADILEMAVSYLQQ-QKKHQMNRS 85

  Fly    80 SVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVP 144
            .:.        |: ::.:|:..||.....|   |:..       |.||...|:            
 Frog    86 HLL--------PE-NVQDSYYQGYYMCLKE---TVGF-------LHTQENGHI------------ 119

  Fly   145 SLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEA----------SSTSGPMWRPW 195
                       .|:...:|         .:.:|.|||.::          |..|..:||||
 Frog   120 -----------QEENKNLT---------WNDSCLPAPYQSLYQQRVSLQVSPGSMKIWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 22/59 (37%)
ORANGE 97..141 CDD:128787 9/43 (21%)
hes5.10NP_001039178.1 bHLH-O_HES5 23..81 CDD:381467 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.