Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027504.1 | Gene: | bhlhe41 / 613096 | XenbaseID: | XB-GENE-994875 | Length: | 427 | Species: | Xenopus tropicalis |
Alignment Length: | 216 | Identity: | 62/216 - (28%) |
---|---|---|---|
Similarity: | 100/216 - (46%) | Gaps: | 39/216 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMK 68
Fly 69 ---KLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPG-VSVDLG-TQL 128
Fly 129 MSHL----GHRLNYLQVVVPSLPIGVPLQA-------PVEDQAMVTPPPSECDSLE--------- 173
Fly 174 -----SGACSPAPSEASSTSG 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 28/66 (42%) |
ORANGE | 97..141 | CDD:128787 | 14/49 (29%) | ||
bhlhe41 | NP_001027504.1 | bHLH-O_DEC2 | 30..121 | CDD:381593 | 32/88 (36%) |
ORANGE | 128..168 | CDD:128787 | 13/39 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |