DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and bhlhe41

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027504.1 Gene:bhlhe41 / 613096 XenbaseID:XB-GENE-994875 Length:427 Species:Xenopus tropicalis


Alignment Length:216 Identity:62/216 - (28%)
Similarity:100/216 - (46%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMK 68
            |..:||   |:...::|:|||.|||:|:.:|||::.|  .||..|    .||||.:||||::|:|
 Frog    39 ESKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLG----HLEKAVVLELTLKHLK 96

  Fly    69 ---KLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPG-VSVDLG-TQL 128
               .|..|:..::.::..|......|..:..::|.:|:...|.||.:.|:.... .|.|.. |||
 Frog    97 GLTSLTEQQHQKIMALQNGEHALKSPIQTDLDAFHSGFQTCAKEVLQYLSRFESWTSRDQRCTQL 161

  Fly   129 MSHL----GHRLNYLQVVVPSLPIGVPLQA-------PVEDQAMVTPPPSECDSLE--------- 173
            ::||    ...|:..|:::.|:|.|....|       ..|:|....|......:||         
 Frog   162 LNHLHTVSSQILSSSQLLLQSVPGGKGSSASPGRGGQKAENQTNCVPVIQRTHNLELNENDTDTD 226

  Fly   174 -----SGACSPAPSEASSTSG 189
                 .|..:...|:..|:||
 Frog   227 SGYGGEGEKAEGRSDGQSSSG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 28/66 (42%)
ORANGE 97..141 CDD:128787 14/49 (29%)
bhlhe41NP_001027504.1 bHLH-O_DEC2 30..121 CDD:381593 32/88 (36%)
ORANGE 128..168 CDD:128787 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.