DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and hey1

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_997726.1 Gene:hey1 / 58008 ZFINID:ZDB-GENE-000607-70 Length:317 Species:Danio rerio


Alignment Length:206 Identity:55/206 - (26%)
Similarity:88/206 - (42%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQL 76
            |.||..:.::|::||.|||..|.||:.::.....::|.  .:||||:||::||:|:|.|.|    
Zfish    47 QARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS--AKLEKAEILQMTVDHLKMLHA---- 105

  Fly    77 RLSSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGV-SVD-LGTQLMSH------- 131
                 .||  .......::|..:|. |:.....|.::.|:.:.|: :.| |..:|:||       
Zfish   106 -----AGG--KGYFDAHALAMDYRGLGFRECLAETARYLSIIEGLDNTDPLRIRLVSHLNSYASQ 163

  Fly   132 ------LGH------------RLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACS 178
                  |||            .|.:..::......|.||      ....:.|||...|..|.:..
Zfish   164 REAHSGLGHLAWGSAFGTPPSHLAHHLLLQQQQQQGAPL------ARSTSSPPSSNSSSPSSSSP 222

  Fly   179 PAPSEASSTSG 189
            .|||.....||
Zfish   223 SAPSTEPRLSG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 24/61 (39%)
ORANGE 97..141 CDD:128787 14/71 (20%)
hey1NP_997726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 4/11 (36%)
HLH 49..106 CDD:238036 24/67 (36%)
ORANGE 119..165 CDD:128787 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..264 13/47 (28%)
YRPW motif 307..310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.