DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:233 Identity:57/233 - (24%)
Similarity:95/233 - (40%) Gaps:85/233 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK-----KLRAQ 73
            ||..||::|:|||||||:.|.||:.::.....|     .:||.|::|||||..::     :.|.:
Mouse    26 RKARKPLVEKKRRARINESLQELRLLLAGTEVQ-----AKLENAEVLELTVRRVQGALRGRARER 85

  Fly    74 KQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNY 138
            :||:..:               :|.|.|||:...:||...::....:...:..:|::||      
Mouse    86 EQLQAEA---------------SERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHL------ 129

  Fly   139 LQVVVPSLPI--GVPLQAPVED--------------------QAMVTPPPSECDSLESGACS--- 178
                :.|:|:  |...|..:.|                    ::.::.||...|.|    ||   
Mouse   130 ----LESMPLREGSSFQDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDL----CSDLE 186

  Fly   179 ----------PA--PSEASSTSGPM---------WRPW 195
                      ||  |...|::.|.:         ||||
Mouse   187 EIPEAELNRVPAEGPDLVSTSLGSLTAARRAQSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 25/65 (38%)
ORANGE 97..141 CDD:128787 10/43 (23%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/4 (50%)
bHLH_SF 24..81 CDD:412148 24/59 (41%)
Hairy_orange 96..134 CDD:400076 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 11/66 (17%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.