DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HES6

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:242 Identity:57/242 - (23%)
Similarity:92/242 - (38%) Gaps:103/242 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK-----KLRAQ 73
            ||..||::|:|||||||:.|.||:.::.....|     .:||.|::|||||..::     :.|.:
Human    26 RKARKPLVEKKRRARINESLQELRLLLAGAEVQ-----AKLENAEVLELTVRRVQGVLRGRARER 85

  Fly    74 KQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNY 138
            :||:..:               :|.|.|||:...:||...::....:...:..:|::||      
Human    86 EQLQAEA---------------SERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHL------ 129

  Fly   139 LQVVVPSLPI--------------------------------GVPLQAPVEDQAMVTPPPSE--C 169
                :.|:|:                                |.|:.:|        |.|.:  |
Human   130 ----LESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSP--------PGPGDDLC 182

  Fly   170 DSLE---SGACSPAPSEASSTSGP------------------MWRPW 195
            ..||   ....|.||:|     ||                  :||||
Human   183 SDLEEAPEAELSQAPAE-----GPDLVPAALGSLTTAQIARSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 25/65 (38%)
ORANGE 97..141 CDD:128787 10/43 (23%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/4 (50%)
HLH 23..75 CDD:238036 24/53 (45%)
Hairy_orange 96..134 CDD:311465 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205 14/70 (20%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.