Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061115.2 | Gene: | HES6 / 55502 | HGNCID: | 18254 | Length: | 224 | Species: | Homo sapiens |
Alignment Length: | 242 | Identity: | 57/242 - (23%) |
---|---|---|---|
Similarity: | 92/242 - (38%) | Gaps: | 103/242 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK-----KLRAQ 73
Fly 74 KQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNY 138
Fly 139 LQVVVPSLPI--------------------------------GVPLQAPVEDQAMVTPPPSE--C 169
Fly 170 DSLE---SGACSPAPSEASSTSGP------------------MWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 25/65 (38%) |
ORANGE | 97..141 | CDD:128787 | 10/43 (23%) | ||
HES6 | NP_061115.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 2/4 (50%) | |
HLH | 23..75 | CDD:238036 | 24/53 (45%) | ||
Hairy_orange | 96..134 | CDD:311465 | 10/47 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 147..205 | 14/70 (20%) | |||
WRPW motif | 221..224 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140859 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1483774at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.710 |