DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her13

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001017901.1 Gene:her13 / 550600 ZFINID:ZDB-GENE-050228-1 Length:224 Species:Danio rerio


Alignment Length:227 Identity:60/227 - (26%)
Similarity:98/227 - (43%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
            ||..||::|:|||||||:.|.:|:.::.....|     |::|.|::|||||:.::.:...:    
Zfish    25 RKTRKPIVEKKRRARINESLQDLRTLLTNNDLQ-----TKMENAEVLELTVKRVESILQSR---- 80

  Fly    79 SSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVV 143
            |..||.|:..|      :|.|.|||:...:||...::..||:...:..:|::||          :
Zfish    81 SQETGTVTQEA------SERFAAGYIQCMHEVHTFVSTCPGIEARVAAELLNHL----------L 129

  Fly   144 PSLPIGV-PLQAPVEDQAMVTPPPSECDSLESG----------------------------ACS- 178
            .|:|:.. .|...::|  :::.|.|..||.:||                            .|| 
Zfish   130 ESMPLNENHLHEMIKD--LISEPSSSGDSWQSGEAQNPGRHCVSGMSSELPQFLSNPFCDDLCSD 192

  Fly   179 --PAPSEASSTSGP-------------MWRPW 195
              ...:|..|.|..             |||||
Zfish   193 LDETETEERSASAEDTLDFSMVTHSKFMWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/60 (38%)
ORANGE 97..141 CDD:128787 12/43 (28%)
her13NP_001017901.1 HLH 22..71 CDD:238036 22/50 (44%)
Hairy_orange 95..133 CDD:284859 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.