DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HES2

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:193 Identity:58/193 - (30%)
Similarity:90/193 - (46%) Gaps:40/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQL 76
            :.||.:||:||::||||||:.|.:||.:::..|.:|..:.::|||||:||:||..:::|.|... 
Human    12 ELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSW- 75

  Fly    77 RLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQV 141
                      |:|.|  ...:|:|.||......:::.|.|...:...:..:|:.||..|.....:
Human    76 ----------PTAAP--LPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATL 128

  Fly   142 --------VVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGP-MWRPW 195
                    ..||.|...|..||                  ..|.:|.||..|...|| :||||
Human   129 DGGRAGDSSGPSAPAPAPASAP------------------EPASAPVPSPPSPPCGPGLWRPW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 28/61 (46%)
ORANGE 97..141 CDD:128787 10/43 (23%)
HES2NP_061962.2 HLH 12..70 CDD:238036 26/57 (46%)
ORANGE 84..127 CDD:128787 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 15/62 (24%)
WRPW motif 170..173 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.