DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and hey1

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001007911.1 Gene:hey1 / 493293 XenbaseID:XB-GENE-486694 Length:300 Species:Xenopus tropicalis


Alignment Length:258 Identity:57/258 - (22%)
Similarity:96/258 - (37%) Gaps:89/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
            ||..:.::|::||.|||..|.||:.::.....::|.  .:||||:||::||:|:|.|.       
 Frog    49 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS--AKLEKAEILQMTVDHLKMLH------- 104

  Fly    79 SSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGVSV--DLGTQLMSHLGH------ 134
               |.|.....|.. ::|..:|: |:.....||::.|:.:.|:..  .|..:|:|||.:      
 Frog   105 ---TAGGKGYFDAH-ALAMDYRSLGFRECLAEVARYLSIIEGMDTTDPLRVRLVSHLNNYASQRE 165

  Fly   135 RLNYLQVVVPSLPIG-------------------------------------VPLQAPVEDQAMV 162
            ..|.....:..:|.|                                     :|.....|..::.
 Frog   166 AANTAHTGIGHIPWGGTFAHHPHLSHPLLLAQTAHTSANSTSSSTEAHHQNRLPGSPHAETSSLR 230

  Fly   163 TPP-----------------PSECDSLESGACSP---------APSEASST----SGPMWRPW 195
            .||                 |....|:.|.:..|         :|:..|.|    ||..:|||
 Frog   231 VPPNGNIASVLPVVASSKLSPPLLSSMASLSAFPFSFGSFHLLSPNSLSPTTPTPSGKPYRPW 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/60 (38%)
ORANGE 97..141 CDD:128787 12/52 (23%)
hey1NP_001007911.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
bHLH_SF 40..121 CDD:381792 27/84 (32%)
ORANGE 119..165 CDD:128787 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..232 2/32 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..300 7/16 (44%)
YRPW motif 290..293 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.