Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007911.1 | Gene: | hey1 / 493293 | XenbaseID: | XB-GENE-486694 | Length: | 300 | Species: | Xenopus tropicalis |
Alignment Length: | 258 | Identity: | 57/258 - (22%) |
---|---|---|---|
Similarity: | 96/258 - (37%) | Gaps: | 89/258 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
Fly 79 SSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGVSV--DLGTQLMSHLGH------ 134
Fly 135 RLNYLQVVVPSLPIG-------------------------------------VPLQAPVEDQAMV 162
Fly 163 TPP-----------------PSECDSLESGACSP---------APSEASST----SGPMWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 23/60 (38%) |
ORANGE | 97..141 | CDD:128787 | 12/52 (23%) | ||
hey1 | NP_001007911.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..52 | 2/2 (100%) | |
bHLH_SF | 40..121 | CDD:381792 | 27/84 (32%) | ||
ORANGE | 119..165 | CDD:128787 | 11/45 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 199..232 | 2/32 (6%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 278..300 | 7/16 (44%) | |||
YRPW motif | 290..293 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |