DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her11

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001003886.1 Gene:her11 / 445409 ZFINID:ZDB-GENE-040824-4 Length:274 Species:Danio rerio


Alignment Length:211 Identity:65/211 - (30%)
Similarity:97/211 - (45%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKK-- 69
            |:||...::.:||::|:|||.|||..||.|:|::.:..........:||||:||:|.|:::||  
Zfish     9 MTKTEGIKRRLKPVIEKKRRDRINHNLDALRDLLFKNTADTRLQNPKLEKAEILDLAVQYIKKTI 73

  Fly    70 -----LRAQKQLRLSSVTGG--VSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDL--- 124
                 .|...|:...|....  :|| |.| |..::..|.......|||...|    |||.:|   
Zfish    74 RKTETARNSNQMDCKSTQNQFVISP-AGP-LYTSDYCRRFKTSEQNEVLLNL----GVSQNLSGS 132

  Fly   125 ---GTQLMSHLGHRL-----NYLQVVV---PSLPIGVPL-----QAPVEDQAMVTPPPSECDSLE 173
               |.:|:|..|..|     ||.|.::   .|...|..|     ...:...:..:.|||. .:..
Zfish   133 SKTGNKLVSQKGFLLSPPGQNYHQELLLHPESSLYGSSLLRQSTSPSISSSSQYSSPPSS-PTFT 196

  Fly   174 SGACSPAPS-EASSTS 188
            |.:|||:.| ...|||
Zfish   197 STSCSPSSSPPCPSTS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 24/68 (35%)
ORANGE 97..141 CDD:128787 16/54 (30%)
her11NP_001003886.1 HLH 16..71 CDD:238036 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.