DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:199 Identity:68/199 - (34%)
Similarity:101/199 - (50%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLR 71
            :|||..|.||.||:|||:||||:|||||.||.::.|  .|..:.|.|::||::||..:..|:|..
  Fly    12 VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAE--FQGDDAILRMDKAEMLEAALVFMRKQV 74

  Fly    72 AQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRL 136
            .::|..:|.:.             .:||:.||::|.:|:|:.:|..|.:|||:|..:|:|||...
  Fly    75 VKQQAPVSPLP-------------MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEF 126

  Fly   137 NYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESG----------ACSPAPSEASSTSGPM 191
            ..:            |||.....::.|..|.......||          |.||.|.|.:     |
  Fly   127 QRM------------LQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEET-----M 174

  Fly   192 WRPW 195
            ||||
  Fly   175 WRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 29/61 (48%)
ORANGE 97..141 CDD:128787 17/43 (40%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 27/53 (51%)
ORANGE 87..131 CDD:128787 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.