DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:223 Identity:102/223 - (45%)
Similarity:131/223 - (58%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKK 69
            |||||||||||||||:||||||||||||||:|||:|||||.|||||:|||||||||||||:||:|
  Fly     3 MEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRK 67

  Fly    70 LRAQKQLRLSSVTGGV-SPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLG 133
            |:.:..|.|..|..|| ||......:..||||:||||||:::::.|....... ::|.::|..|.
  Fly    68 LKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRKIMKFLS 131

  Fly   134 HRLNYLQVVV------------PSLP-----IGVPL---------QAPVEDQAMVTPPPSECD-- 170
            .||..||..:            ..:|     :..||         .|.:...:.:|......|  
  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVT 196

  Fly   171 SLESGACSPAPSEASSTSG---PMWRPW 195
            |::..|.|...|.:|..||   |:||||
  Fly   197 SVDGNALSETASVSSQESGASEPVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 51/61 (84%)
ORANGE 97..141 CDD:128787 17/43 (40%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 51/58 (88%)
ORANGE 96..136 CDD:128787 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469351
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
98.900

Return to query results.
Submit another query.