DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and E(spl)mgamma-HLH

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster


Alignment Length:217 Identity:111/217 - (51%)
Similarity:140/217 - (64%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEM-EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEH 66
            |:| |||||||||||||||||||||||||||||||||:||..|..||||:|||||||||||||.|
  Fly     4 LQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTH 68

  Fly    67 MKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSH 131
            ::|::.|:|.:.:        |.|..|:.||.||:||:||.||||::|:.:||::|.||||||:|
  Fly    69 LQKMKQQRQHKRA--------SGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTH 125

  Fly   132 LGHRLNYLQVVVPS----LPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPM- 191
            ||.|||.:|   |:    ||:..||...:.::...:.|.|   .:.|.|.|| .|..||||..: 
  Fly   126 LGQRLNQIQ---PAEKEVLPVTAPLSVHIANRDAYSVPIS---PISSYAGSP-NSNTSSTSHSLL 183

  Fly   192 ------------------WRPW 195
                              ||||
  Fly   184 TTIDVTKMEDDSEDEENVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 49/61 (80%)
ORANGE 97..141 CDD:128787 27/43 (63%)
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 49/61 (80%)
ORANGE 91..135 CDD:128787 28/46 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469352
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 1 1.000 - - H43735
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 1 1.000 - - otm49703
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
1110.900

Return to query results.
Submit another query.