Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287710.1 | Gene: | HELT / 391723 | HGNCID: | 33783 | Length: | 242 | Species: | Homo sapiens |
Alignment Length: | 222 | Identity: | 52/222 - (23%) |
---|---|---|---|
Similarity: | 81/222 - (36%) | Gaps: | 77/222 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 MSKTYQYRK---VMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK 68
Fly 69 KLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLG 133
Fly 134 HRL-----------NYLQVVV-----------PSLPIGVPLQAPVEDQAMVTPPPSECDSLESGA 176
Fly 177 ---CSPAPSEAS-----STSGPMWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 24/64 (38%) |
ORANGE | 97..141 | CDD:128787 | 9/54 (17%) | ||
HELT | NP_001287710.1 | bHLH-O_HELT | 14..69 | CDD:381414 | 21/56 (38%) |
Hairy_orange | 87..127 | CDD:400076 | 6/56 (11%) | ||
PRK14951 | <133..>207 | CDD:237865 | 14/59 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140868 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |