DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HES5

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:213 Identity:57/213 - (26%)
Similarity:92/213 - (43%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTV---EH 66
            :|:....:..::.||::|:.||.|||..:::|| :::|......:..::||||||||:.|   :|
Human     8 VELLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLEQEFARHQPNSKLEKADILEMAVSYLKH 71

  Fly    67 MKKLRAQKQLRLSSVTGGVSP-----------------SADPKLSIAESFRAGYVHAANEVSK-- 112
            .|..||:.....||......|                 :|.|| |:.:.:..||.....|..:  
Human    72 SKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPK-SLHQDYSEGYSWCLQEAVQFL 135

  Fly   113 TLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGAC 177
            ||.|    :.|...:|:.|...        .|:.| ..|.:.|....|  .|||    :|.:.|.
Human   136 TLHA----ASDTQMKLLYHFQR--------PPAAP-AAPAKEPKAPGA--APPP----ALSAKAT 181

  Fly   178 SPAPSEASSTSGPMWRPW 195
            :.|.:......| :||||
Human   182 AAAAAAHQPACG-LWRPW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 24/64 (38%)
ORANGE 97..141 CDD:128787 9/45 (20%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 20/57 (35%)
Hairy_orange 118..153 CDD:295407 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.