DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and dpn

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:235 Identity:64/235 - (27%)
Similarity:111/235 - (47%) Gaps:75/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLR 71
            :||. :.||..||::|::||||||.||:|||.:::|.:.::....|:||||||||:||:|::.::
  Fly    35 LSKA-ELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQ 98

  Fly    72 AQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRL 136
            .| ||.::.       .:||  |:.:.|:.|:|..|.||::.::.:.|:...:..:|.:||....
  Fly    99 RQ-QLNMAI-------QSDP--SVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCA 153

  Fly   137 NYLQVV---------------------------VPSLP-----------------IG----VPLQ 153
            |.|:.:                           .||||                 :|    :|.:
  Fly   154 NSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSR 218

  Fly   154 APVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPM-W 192
            .|..:.|::.|        .:|:.:|.|       ||. |
  Fly   219 LPSGEFALIMP--------NTGSAAPPP-------GPFAW 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/61 (49%)
ORANGE 97..141 CDD:128787 12/43 (28%)
dpnNP_476923.1 HLH 39..101 CDD:238036 30/62 (48%)
ORANGE 114..158 CDD:128787 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438341
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.