Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_859425.1 | Gene: | heyl / 335134 | ZFINID: | ZDB-GENE-030131-7074 | Length: | 310 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 63/204 - (30%) |
---|---|---|---|
Similarity: | 98/204 - (48%) | Gaps: | 38/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
Fly 79 SSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGV--SVDLGTQLMSHLGHRLNYLQ 140
Fly 141 VVVPSLPIGVP-----------LQAPVEDQAMVTP-PPSECDSLES-------GACSPAPSEAS- 185
Fly 186 STSGPMWRP 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 24/60 (40%) |
ORANGE | 97..141 | CDD:128787 | 15/46 (33%) | ||
heyl | NP_859425.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
HLH | 44..101 | CDD:238036 | 23/58 (40%) | ||
ORANGE | 115..159 | CDD:128787 | 14/43 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..208 | 9/26 (35%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..310 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573723 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |