DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HES1

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:257 Identity:72/257 - (28%)
Similarity:114/257 - (44%) Gaps:84/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75
            ::||..||::|::||||||:.|.:||.::::.|.::....::||||||||:||:|::.| |||..
Human    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQ 140
            ..||:         ||  |:...:|||:....|||::.|:...||:.::.|:|:.||.:.:..:.
Human    98 AALST---------DP--SVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQIN 151

  Fly   141 VVV------PSLPI--------GVPLQAP-------VEDQAMVTPPP--SECD------------ 170
            .:.      |:|..        |.|..||       |.......|||  :.|.            
Human   152 AMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVF 216

  Fly   171 ---------------SLESGA----------------CSPAPSEASSTSGP------MWRPW 195
                           .:.:||                .|..|:..|.:|||      |||||
Human   217 GGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/62 (48%)
ORANGE 97..141 CDD:128787 13/43 (30%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 28/61 (46%)
Hairy_orange 110..148 CDD:400076 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 11/25 (44%)
WRPW motif 275..278 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.