Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005515.1 | Gene: | HES1 / 3280 | HGNCID: | 5192 | Length: | 280 | Species: | Homo sapiens |
Alignment Length: | 257 | Identity: | 72/257 - (28%) |
---|---|---|---|
Similarity: | 114/257 - (44%) | Gaps: | 84/257 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75
Fly 76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQ 140
Fly 141 VVV------PSLPI--------GVPLQAP-------VEDQAMVTPPP--SECD------------ 170
Fly 171 ---------------SLESGA----------------CSPAPSEASSTSGP------MWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 30/62 (48%) |
ORANGE | 97..141 | CDD:128787 | 13/43 (30%) | ||
HES1 | NP_005515.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 4/10 (40%) | |
bHLH-O_HES1_4 | 33..95 | CDD:381465 | 28/61 (46%) | ||
Hairy_orange | 110..148 | CDD:400076 | 13/37 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..200 | 10/42 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 254..280 | 11/25 (44%) | |||
WRPW motif | 275..278 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140908 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3263 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.870 |