DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her8a

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:215 Identity:71/215 - (33%)
Similarity:106/215 - (49%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQLR 77
            ||:.||::|:|||.|||..|::||.|||:....:.   ::|||||:||:||:||:.| |...|  
Zfish    20 RKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQ---SKLEKADVLEITVQHMENLQRGHGQ-- 79

  Fly    78 LSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVV 142
                  |.|.|........:.:.:||:...:||...|.:.||:...||.:|::||...|.::. .
Zfish    80 ------GGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHIS-T 137

  Fly   143 VPS----------LPIGVPLQAPV------EDQAMV---TPPPSECDSL----ESGACSPAPSEA 184
            .||          ||:. |.|:|:      :..|::   :||.|...||    |..:...:||..
Zfish   138 EPSGTSSAGTSSPLPLS-PTQSPINLPSSLQPHALLLSPSPPSSPTHSLVRPREQSSPPSSPSPQ 201

  Fly   185 SSTSGP---------MWRPW 195
            |..|.|         |||||
Zfish   202 SPASLPPFFPGVDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/61 (49%)
ORANGE 97..141 CDD:128787 13/43 (30%)
her8aNP_955918.3 HLH 17..75 CDD:238036 29/57 (51%)
Hairy_orange 95..133 CDD:284859 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 1 1.010 - - QHG47782
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.