DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001013197.1 Gene:Hes6 / 316626 RGDID:1312047 Length:234 Species:Rattus norvegicus


Alignment Length:234 Identity:55/234 - (23%)
Similarity:93/234 - (39%) Gaps:83/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK-----KLR 71
            ::.:..||::|:|||||||:.|.||:.::.....|     .:||.|::|||||..::     :.|
  Rat    34 RFPQARKPLVEKKRRARINESLQELRLLLAGTEVQ-----AKLENAEVLELTVRRVQGALRGRAR 93

  Fly    72 AQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRL 136
            .::||:..:               :|.|.|||:...:||...::....:...:..:|::||...:
  Rat    94 EREQLQAEA---------------SERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESM 143

  Fly   137 ---------NYLQVVVPSLPIG-------------VPLQAPVEDQAMVTPPPSE--CDSLE---S 174
                     :.|...:..||.|             .||.:|        |.|.:  |..||   .
  Rat   144 PLREGSSFRDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSP--------PGPGDDLCSDLEEIPE 200

  Fly   175 GACSPAPSEASSTSGP------------------MWRPW 195
            ...:..|:|     ||                  :||||
  Rat   201 AELNRVPAE-----GPDLVPTSLGILTTARRAQSVWRPW 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/66 (35%)
ORANGE 97..141 CDD:128787 11/52 (21%)
Hes6NP_001013197.1 HLH 37..85 CDD:238036 22/52 (42%)
Hairy_orange 106..144 CDD:284859 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.