DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her3

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:234 Identity:67/234 - (28%)
Similarity:103/234 - (44%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRA 72
            :|....:||.||::|:||||||||||::||.:: |..........:|||||||||||:|::.|:.
Zfish    11 AKPQNVKKVSKPLMEKKRRARINKCLNQLKSLL-ESACSNNIRKRKLEKADILELTVKHLRHLQN 74

  Fly    73 QKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLN 137
            .|:        |:|.:.|     :..:.|||....|.||..|.| .....|..:.::::|...||
Zfish    75 TKR--------GLSKACD-----SAEYHAGYRSCLNTVSHYLRA-SDTDRDSRSIMLTNLTSGLN 125

  Fly   138 YLQV--------------VVPSL---PIGVPLQAPV---------EDQAMVTPPPSECD-----S 171
            :.:|              .:||.   |..||::..|         |.:..:.|..:|..     |
Zfish   126 HNRVPDFSTVESDPALIFTLPSTLRRPHKVPIRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMS 190

  Fly   172 LESGACSPAPSEASST---------------SGPMWRPW 195
            |::...|....:|.:|               ....||||
Zfish   191 LDAALRSQESKKAETTHFRPKDLKVIECCIFKQNYWRPW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 31/61 (51%)
ORANGE 97..141 CDD:128787 12/43 (28%)
her3NP_571155.1 HLH 17..77 CDD:238036 31/60 (52%)
ORANGE 88..129 CDD:128787 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.