DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HEY2

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens


Alignment Length:121 Identity:40/121 - (33%)
Similarity:66/121 - (54%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
            ||..:.::|::||.|||..|.||:.::.....::|.  .:||||:||::||:|:|.|:|      
Human    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQA------ 105

  Fly    79 SSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGV--SVDLGTQLMSHL 132
               ||| ....|......:....|:.....||::.|::|.|:  |..|..:|:|||
Human   106 ---TGG-KGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 24/60 (40%)
ORANGE 97..141 CDD:128787 12/38 (32%)
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
bHLH-O_HEY2 40..121 CDD:381490 28/83 (34%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 28/78 (36%)
ORANGE 119..165 CDD:128787 12/39 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337
YRPW motif 327..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.