DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and HEY1

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:266 Identity:64/266 - (24%)
Similarity:103/266 - (38%) Gaps:98/266 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVEC----LTQEGEHITRLEKADILELTVEHMKKLRAQK 74
            ||..:.::|::||.|||..|.||:.::...    :.::|.  .:||||:||::||:|:|.|.   
Human    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGS--AKLEKAEILQMTVDHLKMLH--- 109

  Fly    75 QLRLSSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGV--SVDLGTQLMSHL---- 132
                   |.|.....|.. ::|..:|: |:.....||::.|:.:.|:  |..|..:|:|||    
Human   110 -------TAGGKGYFDAH-ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYA 166

  Fly   133 -------------------------------------GH----------------RLNYLQVVVP 144
                                                 ||                ||.......|
Human   167 SQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAP 231

  Fly   145 SL---PIGV--PLQAPVEDQAMVTPP-----------PSECDS---LESGACSP-APSEASSTSG 189
            :|   |.|.  |:...|...:.::||           |....|   |...|.|| ||::|::...
Human   232 ALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGK 296

  Fly   190 PMWRPW 195
            | :|||
Human   297 P-YRPW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/64 (36%)
ORANGE 97..141 CDD:128787 16/103 (16%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
bHLH_SF 41..126 CDD:381792 27/88 (31%)
ORANGE 124..170 CDD:128787 12/45 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 6/37 (16%)
YRPW motif 298..301 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.