DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Bhlhe40

DIOPT Version :10

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus


Alignment Length:198 Identity:58/198 - (29%)
Similarity:92/198 - (46%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMK 68
            :..:||   |:...::|:|||.|||:|:.:|||::.|  .||..|    .||||.:||||::|:|
Mouse    48 DSKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLG----HLEKAVVLELTLKHVK 105

  Fly    69 KLR---AQKQLRLSSVTGGVSPS--ADPKLSIA-ESFRAGYVHAANEVSKTLAAVPGVSVDLGTQ 127
            .|.   .|:|.::.::..|:...  :...|... |.|.:|:...|.||.:.||..........:|
Mouse   106 ALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQ 170

  Fly   128 LMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGA------CSPAPSEASS 186
            |::|| ||      ||..|..|...:.|::..........:...|..|:      |.|......:
Mouse   171 LVTHL-HR------VVSELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGPGKNCVPVIQRTFA 228

  Fly   187 TSG 189
            .||
Mouse   229 PSG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 bHLH-O_ESMB_like 7..75 CDD:381584 30/72 (42%)
ORANGE 97..141 CDD:128787 14/43 (33%)
Bhlhe40NP_035628.1 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 33/97 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 32/87 (37%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 3/3 (100%)
ORANGE 140..184 CDD:128787 17/50 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..294 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.