DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment E(spl)mbeta-HLH and Hey2

DIOPT Version :9

Sequence 1:	NP_524505.2	Gene:	E(spl)mbeta-HLH / 43152	FlyBaseID:	FBgn0002733	Length:	195	Species:	Drosophila melanogaster
Sequence 2:	NP_038932.1	Gene:	Hey2 / 15214	MGIID:	1341884	Length:	339	Species:	Mus musculus

Alignment Length:	121	Identity:	40/121 - (33%)
Similarity:	66/121 - (54%)	Gaps:	14/121 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78
            ||..:.::|::||.|||..|.||:.::.....::|.  .:||||:||::||:|:|.|:|
Mouse    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQA------ 105

  Fly    79 SSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGV--SVDLGTQLMSHL 132
               ||| ....|......:....|:.....||::.|::|.|:  |..|..:|:|||
Mouse   106 ---TGG-KGYFDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHL 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
E(spl)mbeta-HLH	NP_524505.2	HLH	13..75	CDD:238036	24/60 (40%)
E(spl)mbeta-HLH	NP_524505.2	ORANGE	97..141	CDD:128787	12/38 (32%)
Hey2	NP_038932.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..52		2/2 (100%)
		Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000269\|PubMed:11486045	47..116		28/78 (36%)
		HLH	49..105	CDD:238036	23/57 (40%)
		ORANGE	120..165	CDD:128787	12/38 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	310..339
		YQPW motif	329..332
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167830863
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4304
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.740