Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011248491.1 | Gene: | Hes3 / 15207 | MGIID: | 104877 | Length: | 291 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 62/200 - (31%) |
---|---|---|---|
Similarity: | 87/200 - (43%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITR---LEKADILELTVEHMKKLRAQKQLR 77
Fly 78 LSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHR------- 135
Fly 136 --LNYLQVVVPSLP-IGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGP------- 190
Fly 191 MWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 27/61 (44%) |
ORANGE | 97..141 | CDD:128787 | 10/52 (19%) | ||
Hes3 | XP_011248491.1 | bHLH-O_HES3 | 117..171 | CDD:381503 | 26/58 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830847 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |