DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_011248491.1 Gene:Hes3 / 15207 MGIID:104877 Length:291 Species:Mus musculus


Alignment Length:200 Identity:62/200 - (31%)
Similarity:87/200 - (43%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITR---LEKADILELTVEHMKKLRAQKQLR 77
            :.||::|:|||||||..|::|:.:    |.:...|..|   |||||||||:|::|:.|:...| .
Mouse   112 ISKPLMEKKRRARINVSLEQLRSL----LERHYSHQIRKRKLEKADILELSVKYMRSLQNSLQ-G 171

  Fly    78 LSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHR------- 135
            |..|..||            .:.:|:......||:.|.  ||.. |.|.:....|..|       
Mouse   172 LWPVPSGV------------DYPSGFQGGLRGVSQRLR--PGEG-DSGLRCPLLLQRREGSTTDS 221

  Fly   136 --LNYLQVVVPSLP-IGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGP------- 190
              .....|:.|.|| |..|.:|.....:..:|.|.....|||.....||..||:....       
Mouse   222 ANPQATSVLNPCLPAIWAPSRAAGGSHSPQSPLPLPGGLLESSTDVVAPHPASNCQAESTRPGFR 286

  Fly   191 MWRPW 195
            :||||
Mouse   287 VWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 27/61 (44%)
ORANGE 97..141 CDD:128787 10/52 (19%)
Hes3XP_011248491.1 bHLH-O_HES3 117..171 CDD:381503 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.