DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:195 Identity:59/195 - (30%)
Similarity:85/195 - (43%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVE 65
            |.|...:....:.||.:||:||::||||||:.|.:||.:::..|..|....::||||||||:|| 
Mouse     1 MRLPRRVEDAAELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTV- 64

  Fly    66 HMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMS 130
              :.|:.|.....||...|      |..|..|.:||.....|..:.......|.||    .:|:.
Mouse    65 --RFLQEQPATLYSSAAPG------PLNSYLEGYRACLARLARVLPACSVLEPAVS----ARLLE 117

  Fly   131 HLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW 195
            ||..|                  ...:|...:|.||:.       |.:|:|......|..:||||
Mouse   118 HLRQR------------------TVSDDSPSLTLPPAP-------APAPSPPVPPPGSSGLWRPW 157

  Fly   196  195
            Mouse   158  157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 29/61 (48%)
ORANGE 97..141 CDD:128787 11/43 (26%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 29/65 (45%)
ORANGE 85..123 CDD:128787 12/59 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 10/39 (26%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5264
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.