DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her9

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:270 Identity:72/270 - (26%)
Similarity:116/270 - (42%) Gaps:97/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75
            ::||..||::|::||||||:.|.:||.::::.|.::....::||||||||:||:|::.| |.|..
Zfish    33 EHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMS 97

  Fly    76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLG------H 134
            ..||:.|           ::...:|||:....|||::.|:...||:.::.::|::||.      .
Zfish    98 AALSADT-----------NVLSKYRAGFNECMNEVTRFLSTCEGVNTEVRSRLLNHLSGCMGQMM 151

  Fly   135 RLNY--------------LQVVVPS-LPI---------------------GVPLQAPVEDQ-AMV 162
            .:||              |.|.:|| |||                     |..|....:.| |.:
Zfish   152 AMNYPQPAPAQQAHLAQPLHVQLPSTLPINGASMGSKLSPSEAVSPKVFGGFQLVPATDGQFAFL 216

  Fly   163 TPPPSECDS------LESGACSP------------APSEASSTSG-------------------- 189
            .|.|:...:      |.:.|..|            ||:.||...|                    
Zfish   217 IPNPAFASATTPVIPLYANASVPVTVNASPVQASSAPTVASPVQGMTSFSGVPQAVSPVGVSAGA 281

  Fly   190 ----PMWRPW 195
                |:||||
Zfish   282 ESNEPVWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 29/62 (47%)
ORANGE 97..141 CDD:128787 15/63 (24%)
her9NP_571948.1 HLH 32..93 CDD:238036 27/59 (46%)
Hairy_orange 110..147 CDD:284859 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.