Sequence 1: | NP_524505.2 | Gene: | E(spl)mbeta-HLH / 43152 | FlyBaseID: | FBgn0002733 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571948.1 | Gene: | her9 / 140613 | ZFINID: | ZDB-GENE-011213-1 | Length: | 291 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 72/270 - (26%) |
---|---|---|---|
Similarity: | 116/270 - (42%) | Gaps: | 97/270 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75
Fly 76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLG------H 134
Fly 135 RLNY--------------LQVVVPS-LPI---------------------GVPLQAPVEDQ-AMV 162
Fly 163 TPPPSECDS------LESGACSP------------APSEASSTSG-------------------- 189
Fly 190 ----PMWRPW 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mbeta-HLH | NP_524505.2 | HLH | 13..75 | CDD:238036 | 29/62 (47%) |
ORANGE | 97..141 | CDD:128787 | 15/63 (24%) | ||
her9 | NP_571948.1 | HLH | 32..93 | CDD:238036 | 27/59 (46%) |
Hairy_orange | 110..147 | CDD:284859 | 12/36 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573819 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3263 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.870 |