DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:195 Identity:59/195 - (30%)
Similarity:95/195 - (48%) Gaps:43/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TYQYRKVMKPMLERKRRARINKCLDELKDIMVE--CLTQEGEHITRLEKADILELTVEHMKKLRA 72
            ||   |:...::|:|||.|||:|:.:|||::.|  .||..|    .||||.:||||::|:|.|.|
  Rat    44 TY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLG----HLEKAVVLELTLKHLKALTA 101

  Fly    73 ---QKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAV-------PGVSVDLGTQ 127
               |:..::.::..|......|..:..::|.:|:...|.||.:.||..       |..:     |
  Rat   102 LTEQQHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRCA-----Q 161

  Fly   128 LMSHLGHRLNYLQVVVPSLPIG-VPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPM 191
            |:||| |.: ..|::.|.:..| .|.:||             |   .:||.:.:.||..:...|:
  Rat   162 LVSHL-HAV-ATQLLTPQVTPGRGPGRAP-------------C---SAGAAAASGSERVARCVPV 208

  Fly   192  191
              Rat   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 29/66 (44%)
ORANGE 97..141 CDD:128787 14/50 (28%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 32/84 (38%)
ORANGE 129..175 CDD:128787 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.